Description
Product Description
Protein Description: glucoside xylosyltransferase 2
Gene Name: GXYLT2
Alternative Gene Name: GLT8D4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030074: 86%, ENSRNOG00000005621: 93%
Entrez Gene ID: 727936
Uniprot ID: A0PJZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GXYLT2
Alternative Gene Name: GLT8D4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030074: 86%, ENSRNOG00000005621: 93%
Entrez Gene ID: 727936
Uniprot ID: A0PJZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ |
| Gene Sequence | MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ |
| Gene ID - Mouse | ENSMUSG00000030074 |
| Gene ID - Rat | ENSRNOG00000005621 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti GXYLT2 pAb (ATL-HPA068429) | |
| Datasheet | Anti GXYLT2 pAb (ATL-HPA068429) Datasheet (External Link) |
| Vendor Page | Anti GXYLT2 pAb (ATL-HPA068429) at Atlas Antibodies |
| Documents & Links for Anti GXYLT2 pAb (ATL-HPA068429) | |
| Datasheet | Anti GXYLT2 pAb (ATL-HPA068429) Datasheet (External Link) |
| Vendor Page | Anti GXYLT2 pAb (ATL-HPA068429) |