Protein Description: GVQW motif containing 1
Gene Name: GVQW1
Alternative Gene Name: bA205M20.5, TIGD1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079560: 30%, ENSRNOG00000012197: 33%
Entrez Gene ID:
Uniprot ID: Q8N7I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GVQW1
Alternative Gene Name: bA205M20.5, TIGD1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079560: 30%, ENSRNOG00000012197: 33%
Entrez Gene ID:
Uniprot ID: Q8N7I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS |
Documents & Links for Anti GVQW1 pAb (ATL-HPA074576) | |
Datasheet | Anti GVQW1 pAb (ATL-HPA074576) Datasheet (External Link) |
Vendor Page | Anti GVQW1 pAb (ATL-HPA074576) at Atlas |
Documents & Links for Anti GVQW1 pAb (ATL-HPA074576) | |
Datasheet | Anti GVQW1 pAb (ATL-HPA074576) Datasheet (External Link) |
Vendor Page | Anti GVQW1 pAb (ATL-HPA074576) |