Protein Description: GULP, engulfment adaptor PTB domain containing 1
Gene Name: GULP1
Alternative Gene Name: CED-6, CED6, GULP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056870: 94%, ENSRNOG00000003242: 95%
Entrez Gene ID: 51454
Uniprot ID: Q9UBP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GULP1
Alternative Gene Name: CED-6, CED6, GULP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056870: 94%, ENSRNOG00000003242: 95%
Entrez Gene ID: 51454
Uniprot ID: Q9UBP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA |
| Documents & Links for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) | |
| Datasheet | Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) at Atlas |
| Documents & Links for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) | |
| Datasheet | Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) |
| Citations for Anti GULP1 pAb (ATL-HPA020587 w/enhanced validation) – 1 Found |
| Gong, Jingyi; Gaitanos, Thomas N; Luu, Olivia; Huang, Yunyun; Gaitanos, Louise; Lindner, Jana; Winklbauer, Rudolf; Klein, Rüdiger. Gulp1 controls Eph/ephrin trogocytosis and is important for cell rearrangements during development. The Journal Of Cell Biology. 2019;218(10):3455-3471. PubMed |