Protein Description: guanylate kinase 1
Gene Name: GUK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020444: 92%, ENSRNOG00000002928: 92%
Entrez Gene ID: 2987
Uniprot ID: Q16774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GUK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020444: 92%, ENSRNOG00000002928: 92%
Entrez Gene ID: 2987
Uniprot ID: Q16774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATD |
Documents & Links for Anti GUK1 pAb (ATL-HPA068324) | |
Datasheet | Anti GUK1 pAb (ATL-HPA068324) Datasheet (External Link) |
Vendor Page | Anti GUK1 pAb (ATL-HPA068324) at Atlas |
Documents & Links for Anti GUK1 pAb (ATL-HPA068324) | |
Datasheet | Anti GUK1 pAb (ATL-HPA068324) Datasheet (External Link) |
Vendor Page | Anti GUK1 pAb (ATL-HPA068324) |