Protein Description: GTP binding protein 1
Gene Name: GTPBP1
Alternative Gene Name: GP-1, HSPC018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042535: 100%, ENSRNOG00000014634: 100%
Entrez Gene ID: 9567
Uniprot ID: O00178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GTPBP1
Alternative Gene Name: GP-1, HSPC018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042535: 100%, ENSRNOG00000014634: 100%
Entrez Gene ID: 9567
Uniprot ID: O00178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQ |
| Documents & Links for Anti GTPBP1 pAb (ATL-HPA064702) | |
| Datasheet | Anti GTPBP1 pAb (ATL-HPA064702) Datasheet (External Link) |
| Vendor Page | Anti GTPBP1 pAb (ATL-HPA064702) at Atlas |
| Documents & Links for Anti GTPBP1 pAb (ATL-HPA064702) | |
| Datasheet | Anti GTPBP1 pAb (ATL-HPA064702) Datasheet (External Link) |
| Vendor Page | Anti GTPBP1 pAb (ATL-HPA064702) |