Protein Description: general transcription factor IIIC, polypeptide 5, 63kDa
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA |
| Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063) | |
| Datasheet | Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link) |
| Vendor Page | Anti GTF3C5 pAb (ATL-HPA067063) at Atlas |
| Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063) | |
| Datasheet | Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link) |
| Vendor Page | Anti GTF3C5 pAb (ATL-HPA067063) |