Description
Product Description
Protein Description: general transcription factor IIIC, polypeptide 5, 63kDa
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA |
Gene Sequence | HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA |
Gene ID - Mouse | ENSMUSG00000026816 |
Gene ID - Rat | ENSRNOG00000010981 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063) | |
Datasheet | Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link) |
Vendor Page | Anti GTF3C5 pAb (ATL-HPA067063) at Atlas Antibodies |
Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063) | |
Datasheet | Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link) |
Vendor Page | Anti GTF3C5 pAb (ATL-HPA067063) |