Anti GTF3C5 pAb (ATL-HPA067063)

Catalog No:
ATL-HPA067063-25
$447.00

Description

Product Description

Protein Description: general transcription factor IIIC, polypeptide 5, 63kDa
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
Gene Sequence HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
Gene ID - Mouse ENSMUSG00000026816
Gene ID - Rat ENSRNOG00000010981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063)
Datasheet Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link)
Vendor Page Anti GTF3C5 pAb (ATL-HPA067063) at Atlas Antibodies

Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063)
Datasheet Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link)
Vendor Page Anti GTF3C5 pAb (ATL-HPA067063)

Product Description

Protein Description: general transcription factor IIIC, polypeptide 5, 63kDa
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
Gene Sequence HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
Gene ID - Mouse ENSMUSG00000026816
Gene ID - Rat ENSRNOG00000010981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063)
Datasheet Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link)
Vendor Page Anti GTF3C5 pAb (ATL-HPA067063) at Atlas Antibodies

Documents & Links for Anti GTF3C5 pAb (ATL-HPA067063)
Datasheet Anti GTF3C5 pAb (ATL-HPA067063) Datasheet (External Link)
Vendor Page Anti GTF3C5 pAb (ATL-HPA067063)