Description
Product Description
Protein Description: general transcription factor IIIC, polypeptide 3, 102kDa
Gene Name: GTF3C3
Alternative Gene Name: TFIIIC102, TFiiiC2-102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041303: 99%, ENSRNOG00000002091: 99%
Entrez Gene ID: 9330
Uniprot ID: Q9Y5Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GTF3C3
Alternative Gene Name: TFIIIC102, TFiiiC2-102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041303: 99%, ENSRNOG00000002091: 99%
Entrez Gene ID: 9330
Uniprot ID: Q9Y5Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD |
Gene Sequence | RETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGD |
Gene ID - Mouse | ENSMUSG00000041303 |
Gene ID - Rat | ENSRNOG00000002091 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GTF3C3 pAb (ATL-HPA069179) | |
Datasheet | Anti GTF3C3 pAb (ATL-HPA069179) Datasheet (External Link) |
Vendor Page | Anti GTF3C3 pAb (ATL-HPA069179) at Atlas Antibodies |
Documents & Links for Anti GTF3C3 pAb (ATL-HPA069179) | |
Datasheet | Anti GTF3C3 pAb (ATL-HPA069179) Datasheet (External Link) |
Vendor Page | Anti GTF3C3 pAb (ATL-HPA069179) |