Protein Description: general transcription factor IIIC subunit 1
Gene Name: GTF3C1
Alternative Gene Name: TFIIIC220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032777: 97%, ENSRNOG00000016218: 97%
Entrez Gene ID: 2975
Uniprot ID: Q12789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GTF3C1
Alternative Gene Name: TFIIIC220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032777: 97%, ENSRNOG00000016218: 97%
Entrez Gene ID: 2975
Uniprot ID: Q12789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PVDIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKGFMEDEGRQRTTKYISCVFAEESDLSRQYQREKARSELLTTVS |
Documents & Links for Anti GTF3C1 pAb (ATL-HPA075900) | |
Datasheet | Anti GTF3C1 pAb (ATL-HPA075900) Datasheet (External Link) |
Vendor Page | Anti GTF3C1 pAb (ATL-HPA075900) at Atlas |
Documents & Links for Anti GTF3C1 pAb (ATL-HPA075900) | |
Datasheet | Anti GTF3C1 pAb (ATL-HPA075900) Datasheet (External Link) |
Vendor Page | Anti GTF3C1 pAb (ATL-HPA075900) |