Anti GTF3C1 pAb (ATL-HPA075900)

Catalog No:
ATL-HPA075900-25
$447.00

Description

Product Description

Protein Description: general transcription factor IIIC subunit 1
Gene Name: GTF3C1
Alternative Gene Name: TFIIIC220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032777: 97%, ENSRNOG00000016218: 97%
Entrez Gene ID: 2975
Uniprot ID: Q12789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVDIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKGFMEDEGRQRTTKYISCVFAEESDLSRQYQREKARSELLTTVS
Gene Sequence PVDIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKGFMEDEGRQRTTKYISCVFAEESDLSRQYQREKARSELLTTVS
Gene ID - Mouse ENSMUSG00000032777
Gene ID - Rat ENSRNOG00000016218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GTF3C1 pAb (ATL-HPA075900)
Datasheet Anti GTF3C1 pAb (ATL-HPA075900) Datasheet (External Link)
Vendor Page Anti GTF3C1 pAb (ATL-HPA075900) at Atlas Antibodies

Documents & Links for Anti GTF3C1 pAb (ATL-HPA075900)
Datasheet Anti GTF3C1 pAb (ATL-HPA075900) Datasheet (External Link)
Vendor Page Anti GTF3C1 pAb (ATL-HPA075900)

Product Description

Protein Description: general transcription factor IIIC subunit 1
Gene Name: GTF3C1
Alternative Gene Name: TFIIIC220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032777: 97%, ENSRNOG00000016218: 97%
Entrez Gene ID: 2975
Uniprot ID: Q12789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVDIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKGFMEDEGRQRTTKYISCVFAEESDLSRQYQREKARSELLTTVS
Gene Sequence PVDIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKGFMEDEGRQRTTKYISCVFAEESDLSRQYQREKARSELLTTVS
Gene ID - Mouse ENSMUSG00000032777
Gene ID - Rat ENSRNOG00000016218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GTF3C1 pAb (ATL-HPA075900)
Datasheet Anti GTF3C1 pAb (ATL-HPA075900) Datasheet (External Link)
Vendor Page Anti GTF3C1 pAb (ATL-HPA075900) at Atlas Antibodies

Documents & Links for Anti GTF3C1 pAb (ATL-HPA075900)
Datasheet Anti GTF3C1 pAb (ATL-HPA075900) Datasheet (External Link)
Vendor Page Anti GTF3C1 pAb (ATL-HPA075900)