Protein Description: general transcription factor IIH, polypeptide 4, 52kDa
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL |
| Documents & Links for Anti GTF2H4 pAb (ATL-HPA074336) | |
| Datasheet | Anti GTF2H4 pAb (ATL-HPA074336) Datasheet (External Link) |
| Vendor Page | Anti GTF2H4 pAb (ATL-HPA074336) at Atlas |
| Documents & Links for Anti GTF2H4 pAb (ATL-HPA074336) | |
| Datasheet | Anti GTF2H4 pAb (ATL-HPA074336) Datasheet (External Link) |
| Vendor Page | Anti GTF2H4 pAb (ATL-HPA074336) |