Anti GTF2H4 pAb (ATL-HPA074336)

Catalog No:
ATL-HPA074336-25
$303.00

Description

Product Description

Protein Description: general transcription factor IIH, polypeptide 4, 52kDa
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Gene Sequence EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Gene ID - Mouse ENSMUSG00000001524
Gene ID - Rat ENSRNOG00000000831
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GTF2H4 pAb (ATL-HPA074336)
Datasheet Anti GTF2H4 pAb (ATL-HPA074336) Datasheet (External Link)
Vendor Page Anti GTF2H4 pAb (ATL-HPA074336) at Atlas Antibodies

Documents & Links for Anti GTF2H4 pAb (ATL-HPA074336)
Datasheet Anti GTF2H4 pAb (ATL-HPA074336) Datasheet (External Link)
Vendor Page Anti GTF2H4 pAb (ATL-HPA074336)

Product Description

Protein Description: general transcription factor IIH, polypeptide 4, 52kDa
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Gene Sequence EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Gene ID - Mouse ENSMUSG00000001524
Gene ID - Rat ENSRNOG00000000831
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GTF2H4 pAb (ATL-HPA074336)
Datasheet Anti GTF2H4 pAb (ATL-HPA074336) Datasheet (External Link)
Vendor Page Anti GTF2H4 pAb (ATL-HPA074336) at Atlas Antibodies

Documents & Links for Anti GTF2H4 pAb (ATL-HPA074336)
Datasheet Anti GTF2H4 pAb (ATL-HPA074336) Datasheet (External Link)
Vendor Page Anti GTF2H4 pAb (ATL-HPA074336)