Anti GTF2H4 pAb (ATL-HPA074336)

Atlas Antibodies

Catalog No: ATL-HPA074336-25

• 

Product Description

Protein Description: general transcription factor IIH, polypeptide 4, 52kDa
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
• Gene Sequence: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
• Gene ID - Mouse: ENSMUSG00000001524
• Gene ID - Rat: ENSRNOG00000000831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.