Anti GTF2F1 pAb (ATL-HPA070752)

Atlas Antibodies

Catalog No: ATL-HPA070752-25

• 

Product Description

Protein Description: general transcription factor IIF subunit 1
Gene Name: GTF2F1
Alternative Gene Name: BTF4, RAP74, TF2F1, TFIIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002658: 85%, ENSRNOG00000047134: 85%
Entrez Gene ID: 2962
Uniprot ID: P35269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP
• Gene Sequence: SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP
• Gene ID - Mouse: ENSMUSG00000002658
• Gene ID - Rat: ENSRNOG00000047134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.