Description
Product Description
Protein Description: G1 to S phase transition 1
Gene Name: GSPT1
Alternative Gene Name: eRF3a, ETF3A, GST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062203: 100%, ENSRNOG00000046271: 100%
Entrez Gene ID: 2935
Uniprot ID: P15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GSPT1
Alternative Gene Name: eRF3a, ETF3A, GST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062203: 100%, ENSRNOG00000046271: 100%
Entrez Gene ID: 2935
Uniprot ID: P15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE |
Gene Sequence | LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE |
Gene ID - Mouse | ENSMUSG00000062203 |
Gene ID - Rat | ENSRNOG00000046271 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GSPT1 pAb (ATL-HPA074588) | |
Datasheet | Anti GSPT1 pAb (ATL-HPA074588) Datasheet (External Link) |
Vendor Page | Anti GSPT1 pAb (ATL-HPA074588) at Atlas Antibodies |
Documents & Links for Anti GSPT1 pAb (ATL-HPA074588) | |
Datasheet | Anti GSPT1 pAb (ATL-HPA074588) Datasheet (External Link) |
Vendor Page | Anti GSPT1 pAb (ATL-HPA074588) |