Protein Description: glycogen synthase kinase 3 beta
Gene Name: GSK3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022812: 100%, ENSRNOG00000002833: 100%
Entrez Gene ID: 2932
Uniprot ID: P49841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GSK3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022812: 100%, ENSRNOG00000002833: 100%
Entrez Gene ID: 2932
Uniprot ID: P49841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS |
Documents & Links for Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) | |
Datasheet | Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) at Atlas |
Documents & Links for Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) | |
Datasheet | Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) |