Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation)

Catalog No:
ATL-HPA028017-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: glycogen synthase kinase 3 beta
Gene Name: GSK3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022812: 100%, ENSRNOG00000002833: 100%
Entrez Gene ID: 2932
Uniprot ID: P49841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS
Gene Sequence SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS
Gene ID - Mouse ENSMUSG00000022812
Gene ID - Rat ENSRNOG00000002833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation)
Datasheet Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) at Atlas

Documents & Links for Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation)
Datasheet Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSK3B pAb (ATL-HPA028017 w/enhanced validation)