Protein Description: gasdermin A
Gene Name: GSDMA
Alternative Gene Name: FLJ39120, GSDM, GSDM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017204: 95%, ENSRNOG00000007943: 92%
Entrez Gene ID: 284110
Uniprot ID: Q96QA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GSDMA
Alternative Gene Name: FLJ39120, GSDM, GSDM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017204: 95%, ENSRNOG00000007943: 92%
Entrez Gene ID: 284110
Uniprot ID: Q96QA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAG |
Documents & Links for Anti GSDMA pAb (ATL-HPA064826 w/enhanced validation) | |
Datasheet | Anti GSDMA pAb (ATL-HPA064826 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GSDMA pAb (ATL-HPA064826 w/enhanced validation) at Atlas |
Documents & Links for Anti GSDMA pAb (ATL-HPA064826 w/enhanced validation) | |
Datasheet | Anti GSDMA pAb (ATL-HPA064826 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GSDMA pAb (ATL-HPA064826 w/enhanced validation) |