Protein Description: glutamate receptor, metabotropic 2
Gene Name: GRM2
Alternative Gene Name: GPRC1B, mGlu2, MGLUR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023192: 97%, ENSRNOG00000013171: 97%
Entrez Gene ID: 2912
Uniprot ID: Q14416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRM2
Alternative Gene Name: GPRC1B, mGlu2, MGLUR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023192: 97%, ENSRNOG00000013171: 97%
Entrez Gene ID: 2912
Uniprot ID: Q14416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQES |
| Documents & Links for Anti GRM2 pAb (ATL-HPA065166) | |
| Datasheet | Anti GRM2 pAb (ATL-HPA065166) Datasheet (External Link) |
| Vendor Page | Anti GRM2 pAb (ATL-HPA065166) at Atlas |
| Documents & Links for Anti GRM2 pAb (ATL-HPA065166) | |
| Datasheet | Anti GRM2 pAb (ATL-HPA065166) Datasheet (External Link) |
| Vendor Page | Anti GRM2 pAb (ATL-HPA065166) |