Anti GRK7 pAb (ATL-HPA078232)

Catalog No:
ATL-HPA078232-25
$447.00
Protein Description: G protein-coupled receptor kinase 7
Gene Name: GRK7
Alternative Gene Name: GPRK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006731: 28%, ENSRNOG00000012701: 27%
Entrez Gene ID: 131890
Uniprot ID: Q8WTQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence EEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSD
Gene ID - Mouse ENSMUSG00000006731
Gene ID - Rat ENSMUSG00000006731
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti GRK7 pAb (ATL-HPA078232)
Datasheet Anti GRK7 pAb (ATL-HPA078232) Datasheet (External Link)
Vendor Page Anti GRK7 pAb (ATL-HPA078232) at Atlas

Documents & Links for Anti GRK7 pAb (ATL-HPA078232)
Datasheet Anti GRK7 pAb (ATL-HPA078232) Datasheet (External Link)
Vendor Page Anti GRK7 pAb (ATL-HPA078232)