Protein Description: G protein-coupled receptor kinase 7
Gene Name: GRK7
Alternative Gene Name: GPRK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006731: 28%, ENSRNOG00000012701: 27%
Entrez Gene ID: 131890
Uniprot ID: Q8WTQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRK7
Alternative Gene Name: GPRK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006731: 28%, ENSRNOG00000012701: 27%
Entrez Gene ID: 131890
Uniprot ID: Q8WTQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSD |
Gene ID - Mouse | ENSMUSG00000006731 |
Gene ID - Rat | ENSMUSG00000006731 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRK7 pAb (ATL-HPA078232) | |
Datasheet | Anti GRK7 pAb (ATL-HPA078232) Datasheet (External Link) |
Vendor Page | Anti GRK7 pAb (ATL-HPA078232) at Atlas |
Documents & Links for Anti GRK7 pAb (ATL-HPA078232) | |
Datasheet | Anti GRK7 pAb (ATL-HPA078232) Datasheet (External Link) |
Vendor Page | Anti GRK7 pAb (ATL-HPA078232) |