Anti GRIK5 pAb (ATL-HPA074001)

Catalog No:
ATL-HPA074001-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: glutamate ionotropic receptor kainate type subunit 5
Gene Name: GRIK5
Alternative Gene Name: GluK5, GRIK2, KA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003378: 99%, ENSRNOG00000020310: 99%
Entrez Gene ID: 2901
Uniprot ID: Q16478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY
Gene Sequence KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY
Gene ID - Mouse ENSMUSG00000003378
Gene ID - Rat ENSRNOG00000020310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRIK5 pAb (ATL-HPA074001)
Datasheet Anti GRIK5 pAb (ATL-HPA074001) Datasheet (External Link)
Vendor Page Anti GRIK5 pAb (ATL-HPA074001) at Atlas Antibodies

Documents & Links for Anti GRIK5 pAb (ATL-HPA074001)
Datasheet Anti GRIK5 pAb (ATL-HPA074001) Datasheet (External Link)
Vendor Page Anti GRIK5 pAb (ATL-HPA074001)