Protein Description: glutamate ionotropic receptor kainate type subunit 5
Gene Name: GRIK5
Alternative Gene Name: GluK5, GRIK2, KA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003378: 99%, ENSRNOG00000020310: 99%
Entrez Gene ID: 2901
Uniprot ID: Q16478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRIK5
Alternative Gene Name: GluK5, GRIK2, KA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003378: 99%, ENSRNOG00000020310: 99%
Entrez Gene ID: 2901
Uniprot ID: Q16478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY |
Gene ID - Mouse | ENSMUSG00000003378 |
Gene ID - Rat | ENSMUSG00000003378 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRIK5 pAb (ATL-HPA074001) | |
Datasheet | Anti GRIK5 pAb (ATL-HPA074001) Datasheet (External Link) |
Vendor Page | Anti GRIK5 pAb (ATL-HPA074001) at Atlas |
Documents & Links for Anti GRIK5 pAb (ATL-HPA074001) | |
Datasheet | Anti GRIK5 pAb (ATL-HPA074001) Datasheet (External Link) |
Vendor Page | Anti GRIK5 pAb (ATL-HPA074001) |