Protein Description: glutamate receptor, ionotropic, kainate 2
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 99%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 99%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL |
Gene Sequence | ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL |
Gene ID - Mouse | ENSMUSG00000056073 |
Gene ID - Rat | ENSRNOG00000000368 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRIK2 pAb (ATL-HPA014623) | |
Datasheet | Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link) |
Vendor Page | Anti GRIK2 pAb (ATL-HPA014623) at Atlas Antibodies |
Documents & Links for Anti GRIK2 pAb (ATL-HPA014623) | |
Datasheet | Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link) |
Vendor Page | Anti GRIK2 pAb (ATL-HPA014623) |