![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/83189/151470/atl-hpa014623_anti-grik2-pab-atl-hpa014623_33099__07888.1681101252.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp")
Protein Description: glutamate receptor, ionotropic, kainate 2
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 99%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 99%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL |
| Documents & Links for Anti GRIK2 pAb (ATL-HPA014623) | |
| Datasheet | Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link) |
| Vendor Page | Anti GRIK2 pAb (ATL-HPA014623) at Atlas |
| Documents & Links for Anti GRIK2 pAb (ATL-HPA014623) | |
| Datasheet | Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link) |
| Vendor Page | Anti GRIK2 pAb (ATL-HPA014623) |