Anti-GRIK1 pAb (ATL-HPA073879)

Catalog No:
ATL-HPA073879-100
$596.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Polyclonal Antibody against Human GRIK1, Gene description: glutamate ionotropic receptor kainate type subunit 1, Alternative Gene Names: GluK1, GLUR5, Validated applications: ICC, Uniprot ID: P39086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence TEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTL
Gene ID - Mouse ENSMUSG00000022935
Gene ID - Rat ENSMUSG00000022935
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-GRIK1 pAb (ATL-HPA073879)
Vendor Page Anti-GRIK1 pAb (ATL-HPA073879) at Atlas

Documents & Links for Anti-GRIK1 pAb (ATL-HPA073879)
Vendor Page Anti-GRIK1 pAb (ATL-HPA073879)