Protein Description: glutamate ionotropic receptor AMPA type subunit 3
Gene Name: GRIA3
Alternative Gene Name: GluA3, GLUR3, GLURC, MRX94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001986: 98%, ENSRNOG00000007682: 98%
Entrez Gene ID: 2892
Uniprot ID: P42263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRIA3
Alternative Gene Name: GluA3, GLUR3, GLURC, MRX94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001986: 98%, ENSRNOG00000007682: 98%
Entrez Gene ID: 2892
Uniprot ID: P42263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSEN |
Documents & Links for Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) | |
Datasheet | Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) at Atlas |
Documents & Links for Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) | |
Datasheet | Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) |