Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation)

Catalog No:
ATL-HPA073344-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: glutamate ionotropic receptor AMPA type subunit 3
Gene Name: GRIA3
Alternative Gene Name: GluA3, GLUR3, GLURC, MRX94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001986: 98%, ENSRNOG00000007682: 98%
Entrez Gene ID: 2892
Uniprot ID: P42263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSEN
Gene ID - Mouse ENSMUSG00000001986
Gene ID - Rat ENSMUSG00000001986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation)
Datasheet Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) at Atlas

Documents & Links for Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation)
Datasheet Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRIA3 pAb (ATL-HPA073344 w/enhanced validation)