Protein Description: glutamate receptor, ionotropic, AMPA 1
Gene Name: GRIA1
Alternative Gene Name: GluA1, GLUR1, GLURA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020524: 100%, ENSRNOG00000045816: 100%
Entrez Gene ID: 2890
Uniprot ID: P42261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRIA1
Alternative Gene Name: GluA1, GLUR1, GLURA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020524: 100%, ENSRNOG00000045816: 100%
Entrez Gene ID: 2890
Uniprot ID: P42261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN |
Gene Sequence | VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN |
Gene ID - Mouse | ENSMUSG00000020524 |
Gene ID - Rat | ENSRNOG00000045816 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRIA1 pAb (ATL-HPA035202) | |
Datasheet | Anti GRIA1 pAb (ATL-HPA035202) Datasheet (External Link) |
Vendor Page | Anti GRIA1 pAb (ATL-HPA035202) at Atlas |
Documents & Links for Anti GRIA1 pAb (ATL-HPA035202) | |
Datasheet | Anti GRIA1 pAb (ATL-HPA035202) Datasheet (External Link) |
Vendor Page | Anti GRIA1 pAb (ATL-HPA035202) |