Anti GRHL2 pAb (ATL-HPA062839)

Atlas Antibodies

Catalog No: ATL-HPA062839-25

• 

Product Description

Protein Description: grainyhead-like transcription factor 2
Gene Name: GRHL2
Alternative Gene Name: BOM, DFNA28, FLJ13782, TFCP2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022286: 90%, ENSRNOG00000007000: 90%
Entrez Gene ID: 79977
Uniprot ID: Q6ISB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV
• Gene Sequence: ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV
• Gene ID - Mouse: ENSMUSG00000022286
• Gene ID - Rat: ENSRNOG00000007000
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.