Description
Product Description
Protein Description: grainyhead-like transcription factor 2
Gene Name: GRHL2
Alternative Gene Name: BOM, DFNA28, FLJ13782, TFCP2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022286: 90%, ENSRNOG00000007000: 90%
Entrez Gene ID: 79977
Uniprot ID: Q6ISB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRHL2
Alternative Gene Name: BOM, DFNA28, FLJ13782, TFCP2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022286: 90%, ENSRNOG00000007000: 90%
Entrez Gene ID: 79977
Uniprot ID: Q6ISB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV |
Gene Sequence | ANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRV |
Gene ID - Mouse | ENSMUSG00000022286 |
Gene ID - Rat | ENSRNOG00000007000 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GRHL2 pAb (ATL-HPA062839) | |
Datasheet | Anti GRHL2 pAb (ATL-HPA062839) Datasheet (External Link) |
Vendor Page | Anti GRHL2 pAb (ATL-HPA062839) at Atlas Antibodies |
Documents & Links for Anti GRHL2 pAb (ATL-HPA062839) | |
Datasheet | Anti GRHL2 pAb (ATL-HPA062839) Datasheet (External Link) |
Vendor Page | Anti GRHL2 pAb (ATL-HPA062839) |