Anti GRASP pAb (ATL-HPA062028)

Atlas Antibodies

Catalog No: ATL-HPA062028-25

• 

Product Description

Protein Description: GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein
Gene Name: GRASP
Alternative Gene Name: Tamalin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000531: 91%, ENSRNOG00000007346: 93%
Entrez Gene ID: 160622
Uniprot ID: Q7Z6J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PADELYAALEDYHPAELYRALAVSGGTLPRRKGSGFRWKNLSQSPEQQRKVLTLEKED
• Gene Sequence: PADELYAALEDYHPAELYRALAVSGGTLPRRKGSGFRWKNLSQSPEQQRKVLTLEKED
• Gene ID - Mouse: ENSMUSG00000000531
• Gene ID - Rat: ENSRNOG00000007346
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.