Protein Description: GRAM domain containing 1B
Gene Name: GRAMD1B
Alternative Gene Name: KIAA1201, LINC01059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040111: 92%, ENSRNOG00000053577: 92%
Entrez Gene ID: 57476
Uniprot ID: Q3KR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRAMD1B
Alternative Gene Name: KIAA1201, LINC01059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040111: 92%, ENSRNOG00000053577: 92%
Entrez Gene ID: 57476
Uniprot ID: Q3KR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RFKMRRMKNVQEQSLEAGLARDLPAVLAPGKEFLQLPSIEITPSSDEDTPWSNCSTPSASPRRKRFLLRKWLRVRERKECSESSSSLRI |
| Documents & Links for Anti GRAMD1B pAb (ATL-HPA075204) | |
| Datasheet | Anti GRAMD1B pAb (ATL-HPA075204) Datasheet (External Link) |
| Vendor Page | Anti GRAMD1B pAb (ATL-HPA075204) at Atlas |
| Documents & Links for Anti GRAMD1B pAb (ATL-HPA075204) | |
| Datasheet | Anti GRAMD1B pAb (ATL-HPA075204) Datasheet (External Link) |
| Vendor Page | Anti GRAMD1B pAb (ATL-HPA075204) |