Description
Product Description
Protein Description: G protein pathway suppressor 2
Gene Name: GPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023170: 94%, ENSRNOG00000016360: 95%
Entrez Gene ID: 2874
Uniprot ID: Q13227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023170: 94%, ENSRNOG00000016360: 95%
Entrez Gene ID: 2874
Uniprot ID: Q13227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
Gene Sequence | VHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
Gene ID - Mouse | ENSMUSG00000023170 |
Gene ID - Rat | ENSRNOG00000016360 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GPS2 pAb (ATL-HPA067540) | |
Datasheet | Anti GPS2 pAb (ATL-HPA067540) Datasheet (External Link) |
Vendor Page | Anti GPS2 pAb (ATL-HPA067540) at Atlas Antibodies |
Documents & Links for Anti GPS2 pAb (ATL-HPA067540) | |
Datasheet | Anti GPS2 pAb (ATL-HPA067540) Datasheet (External Link) |
Vendor Page | Anti GPS2 pAb (ATL-HPA067540) |