Description
Product Description
Protein Description: GPRIN family member 3
Gene Name: GPRIN3
Alternative Gene Name: FLJ42625, GRIN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045441: 45%, ENSRNOG00000023657: 52%
Entrez Gene ID: 285513
Uniprot ID: Q6ZVF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPRIN3
Alternative Gene Name: FLJ42625, GRIN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045441: 45%, ENSRNOG00000023657: 52%
Entrez Gene ID: 285513
Uniprot ID: Q6ZVF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SQAETSYGLGKFETRPSEFAEKTTNGHKTDPDCKLSDSCGSISKADHSGSLDPTNKGDAREKKPASPQVVKEKESTGTDTSDAK |
Gene Sequence | SQAETSYGLGKFETRPSEFAEKTTNGHKTDPDCKLSDSCGSISKADHSGSLDPTNKGDAREKKPASPQVVKEKESTGTDTSDAK |
Gene ID - Mouse | ENSMUSG00000045441 |
Gene ID - Rat | ENSRNOG00000023657 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GPRIN3 pAb (ATL-HPA059092) | |
Datasheet | Anti GPRIN3 pAb (ATL-HPA059092) Datasheet (External Link) |
Vendor Page | Anti GPRIN3 pAb (ATL-HPA059092) at Atlas Antibodies |
Documents & Links for Anti GPRIN3 pAb (ATL-HPA059092) | |
Datasheet | Anti GPRIN3 pAb (ATL-HPA059092) Datasheet (External Link) |
Vendor Page | Anti GPRIN3 pAb (ATL-HPA059092) |