Anti GPRIN2 pAb (ATL-HPA070760)

Atlas Antibodies

Catalog No: ATL-HPA070760-25

• 

Product Description

Protein Description: G protein regulated inducer of neurite outgrowth 2
Gene Name: GPRIN2
Alternative Gene Name: KIAA0514, MGC15171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071531: 79%, ENSRNOG00000055042: 73%
Entrez Gene ID: 9721
Uniprot ID: O60269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA
• Gene Sequence: NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA
• Gene ID - Mouse: ENSMUSG00000071531
• Gene ID - Rat: ENSRNOG00000055042
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.