Protein Description: G protein-coupled receptor 37 like 1
Gene Name: GPR37L1
Alternative Gene Name: ETBR-LP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026424: 77%, ENSRNOG00000006237: 81%
Entrez Gene ID: 9283
Uniprot ID: O60883
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPR37L1
Alternative Gene Name: ETBR-LP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026424: 77%, ENSRNOG00000006237: 81%
Entrez Gene ID: 9283
Uniprot ID: O60883
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS |
Documents & Links for Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation) | |
Datasheet | Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation) at Atlas |
Documents & Links for Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation) | |
Datasheet | Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation) |