Anti GPR37L1 pAb (ATL-HPA064454 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064454-25

• 

Product Description

Protein Description: G protein-coupled receptor 37 like 1
Gene Name: GPR37L1
Alternative Gene Name: ETBR-LP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026424: 77%, ENSRNOG00000006237: 81%
Entrez Gene ID: 9283
Uniprot ID: O60883
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS
• Gene Sequence: AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS
• Gene ID - Mouse: ENSMUSG00000026424
• Gene ID - Rat: ENSRNOG00000006237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.