Anti GPR20 pAb (ATL-HPA071337)

Atlas Antibodies

Catalog No: ATL-HPA071337-25

• 

Product Description

Protein Description: G protein-coupled receptor 20
Gene Name: GPR20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045281: 67%, ENSRNOG00000013195: 34%
Entrez Gene ID: 2843
Uniprot ID: Q99678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGP
• Gene Sequence: TVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGP
• Gene ID - Mouse: ENSMUSG00000045281
• Gene ID - Rat: ENSRNOG00000013195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.