Protein Description: G protein-coupled receptor 20
Gene Name: GPR20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045281: 67%, ENSRNOG00000013195: 34%
Entrez Gene ID: 2843
Uniprot ID: Q99678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPR20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045281: 67%, ENSRNOG00000013195: 34%
Entrez Gene ID: 2843
Uniprot ID: Q99678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGP |
Documents & Links for Anti GPR20 pAb (ATL-HPA071337) | |
Datasheet | Anti GPR20 pAb (ATL-HPA071337) Datasheet (External Link) |
Vendor Page | Anti GPR20 pAb (ATL-HPA071337) at Atlas |
Documents & Links for Anti GPR20 pAb (ATL-HPA071337) | |
Datasheet | Anti GPR20 pAb (ATL-HPA071337) Datasheet (External Link) |
Vendor Page | Anti GPR20 pAb (ATL-HPA071337) |