Anti GPR161 pAb (ATL-HPA072047)

Catalog No:
ATL-HPA072047-25
$447.00

Description

Product Description

Protein Description: G protein-coupled receptor 161
Gene Name: GPR161
Alternative Gene Name: RE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040836: 95%, ENSRNOG00000003073: 95%
Entrez Gene ID: 23432
Uniprot ID: Q8N6U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDM
Gene Sequence NKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDM
Gene ID - Mouse ENSMUSG00000040836
Gene ID - Rat ENSRNOG00000003073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GPR161 pAb (ATL-HPA072047)
Datasheet Anti GPR161 pAb (ATL-HPA072047) Datasheet (External Link)
Vendor Page Anti GPR161 pAb (ATL-HPA072047) at Atlas Antibodies

Documents & Links for Anti GPR161 pAb (ATL-HPA072047)
Datasheet Anti GPR161 pAb (ATL-HPA072047) Datasheet (External Link)
Vendor Page Anti GPR161 pAb (ATL-HPA072047)

Product Description

Protein Description: G protein-coupled receptor 161
Gene Name: GPR161
Alternative Gene Name: RE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040836: 95%, ENSRNOG00000003073: 95%
Entrez Gene ID: 23432
Uniprot ID: Q8N6U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDM
Gene Sequence NKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDM
Gene ID - Mouse ENSMUSG00000040836
Gene ID - Rat ENSRNOG00000003073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GPR161 pAb (ATL-HPA072047)
Datasheet Anti GPR161 pAb (ATL-HPA072047) Datasheet (External Link)
Vendor Page Anti GPR161 pAb (ATL-HPA072047) at Atlas Antibodies

Documents & Links for Anti GPR161 pAb (ATL-HPA072047)
Datasheet Anti GPR161 pAb (ATL-HPA072047) Datasheet (External Link)
Vendor Page Anti GPR161 pAb (ATL-HPA072047)