Description
Product Description
Protein Description: G protein-coupled receptor 161
Gene Name: GPR161
Alternative Gene Name: RE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040836: 95%, ENSRNOG00000003073: 95%
Entrez Gene ID: 23432
Uniprot ID: Q8N6U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPR161
Alternative Gene Name: RE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040836: 95%, ENSRNOG00000003073: 95%
Entrez Gene ID: 23432
Uniprot ID: Q8N6U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDM |
Gene Sequence | NKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDM |
Gene ID - Mouse | ENSMUSG00000040836 |
Gene ID - Rat | ENSRNOG00000003073 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GPR161 pAb (ATL-HPA072047) | |
Datasheet | Anti GPR161 pAb (ATL-HPA072047) Datasheet (External Link) |
Vendor Page | Anti GPR161 pAb (ATL-HPA072047) at Atlas Antibodies |
Documents & Links for Anti GPR161 pAb (ATL-HPA072047) | |
Datasheet | Anti GPR161 pAb (ATL-HPA072047) Datasheet (External Link) |
Vendor Page | Anti GPR161 pAb (ATL-HPA072047) |