Description
Product Description
Protein Description: glypican 5
Gene Name: GPC5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022112: 84%, ENSRNOG00000060179: 45%
Entrez Gene ID: 2262
Uniprot ID: P78333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPC5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022112: 84%, ENSRNOG00000060179: 45%
Entrez Gene ID: 2262
Uniprot ID: P78333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG |
Gene Sequence | EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG |
Gene ID - Mouse | ENSMUSG00000022112 |
Gene ID - Rat | ENSRNOG00000060179 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GPC5 pAb (ATL-HPA044081) | |
Datasheet | Anti GPC5 pAb (ATL-HPA044081) Datasheet (External Link) |
Vendor Page | Anti GPC5 pAb (ATL-HPA044081) at Atlas Antibodies |
Documents & Links for Anti GPC5 pAb (ATL-HPA044081) | |
Datasheet | Anti GPC5 pAb (ATL-HPA044081) Datasheet (External Link) |
Vendor Page | Anti GPC5 pAb (ATL-HPA044081) |