Anti GPC5 pAb (ATL-HPA044081)

Catalog No:
ATL-HPA044081-25
$303.00

Description

Product Description

Protein Description: glypican 5
Gene Name: GPC5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022112: 84%, ENSRNOG00000060179: 45%
Entrez Gene ID: 2262
Uniprot ID: P78333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG
Gene Sequence EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG
Gene ID - Mouse ENSMUSG00000022112
Gene ID - Rat ENSRNOG00000060179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GPC5 pAb (ATL-HPA044081)
Datasheet Anti GPC5 pAb (ATL-HPA044081) Datasheet (External Link)
Vendor Page Anti GPC5 pAb (ATL-HPA044081) at Atlas Antibodies

Documents & Links for Anti GPC5 pAb (ATL-HPA044081)
Datasheet Anti GPC5 pAb (ATL-HPA044081) Datasheet (External Link)
Vendor Page Anti GPC5 pAb (ATL-HPA044081)

Product Description

Protein Description: glypican 5
Gene Name: GPC5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022112: 84%, ENSRNOG00000060179: 45%
Entrez Gene ID: 2262
Uniprot ID: P78333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG
Gene Sequence EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG
Gene ID - Mouse ENSMUSG00000022112
Gene ID - Rat ENSRNOG00000060179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GPC5 pAb (ATL-HPA044081)
Datasheet Anti GPC5 pAb (ATL-HPA044081) Datasheet (External Link)
Vendor Page Anti GPC5 pAb (ATL-HPA044081) at Atlas Antibodies

Documents & Links for Anti GPC5 pAb (ATL-HPA044081)
Datasheet Anti GPC5 pAb (ATL-HPA044081) Datasheet (External Link)
Vendor Page Anti GPC5 pAb (ATL-HPA044081)