Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GPC5 antibody. Corresponding GPC5 RNA-seq data are presented for the same tissues.

Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation)

Catalog No:
ATL-HPA040152-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: glypican 5
Gene Name: GPC5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022112: 88%, ENSRNOG00000057702: 24%
Entrez Gene ID: 2262
Uniprot ID: P78333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence AELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSFDQSKEKHGMKTTTRN

Documents & Links for Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation)
Datasheet Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation) at Atlas

Documents & Links for Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation)
Datasheet Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPC5 pAb (ATL-HPA040152 w/enhanced validation)