Protein Description: glycosylphosphatidylinositol anchor attachment 1
Gene Name: GPAA1
Alternative Gene Name: GAA1, hGAA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022561: 95%, ENSRNOG00000029280: 95%
Entrez Gene ID: 8733
Uniprot ID: O43292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GPAA1
Alternative Gene Name: GAA1, hGAA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022561: 95%, ENSRNOG00000029280: 95%
Entrez Gene ID: 8733
Uniprot ID: O43292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPL |
| Documents & Links for Anti GPAA1 pAb (ATL-HPA077224) | |
| Datasheet | Anti GPAA1 pAb (ATL-HPA077224) Datasheet (External Link) |
| Vendor Page | Anti GPAA1 pAb (ATL-HPA077224) at Atlas |
| Documents & Links for Anti GPAA1 pAb (ATL-HPA077224) | |
| Datasheet | Anti GPAA1 pAb (ATL-HPA077224) Datasheet (External Link) |
| Vendor Page | Anti GPAA1 pAb (ATL-HPA077224) |