Protein Description: glutamic-oxaloacetic transaminase 1, soluble
Gene Name: GOT1
Alternative Gene Name: AST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025190: 92%, ENSRNOG00000016356: 95%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GOT1
Alternative Gene Name: AST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025190: 92%, ENSRNOG00000016356: 95%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH |
| Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) | |
| Datasheet | Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) at Atlas |
| Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) | |
| Datasheet | Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) |