Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)

Catalog No:
ATL-HPA064532-25
$395.00

Description

Product Description

Protein Description: glutamic-oxaloacetic transaminase 1, soluble
Gene Name: GOT1
Alternative Gene Name: AST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025190: 92%, ENSRNOG00000016356: 95%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Gene Sequence RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Gene ID - Mouse ENSMUSG00000025190
Gene ID - Rat ENSRNOG00000016356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)
Datasheet Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)
Datasheet Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)

Product Description

Protein Description: glutamic-oxaloacetic transaminase 1, soluble
Gene Name: GOT1
Alternative Gene Name: AST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025190: 92%, ENSRNOG00000016356: 95%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Gene Sequence RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Gene ID - Mouse ENSMUSG00000025190
Gene ID - Rat ENSRNOG00000016356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)
Datasheet Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)
Datasheet Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)