Protein Description: golgi SNAP receptor complex member 1
Gene Name: GOSR1
Alternative Gene Name: GOLIM2, GOS-28, GOS28, GS28, P28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010392: 99%, ENSRNOG00000003971: 99%
Entrez Gene ID: 9527
Uniprot ID: O95249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GOSR1
Alternative Gene Name: GOLIM2, GOS-28, GOS28, GS28, P28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010392: 99%, ENSRNOG00000003971: 99%
Entrez Gene ID: 9527
Uniprot ID: O95249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKR |
Documents & Links for Anti GOSR1 pAb (ATL-HPA020590 w/enhanced validation) | |
Datasheet | Anti GOSR1 pAb (ATL-HPA020590 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOSR1 pAb (ATL-HPA020590 w/enhanced validation) at Atlas |
Documents & Links for Anti GOSR1 pAb (ATL-HPA020590 w/enhanced validation) | |
Datasheet | Anti GOSR1 pAb (ATL-HPA020590 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOSR1 pAb (ATL-HPA020590 w/enhanced validation) |