Protein Description: gon-4-like (C. elegans)
Gene Name: GON4L
Alternative Gene Name: FLJ20203, GON-4, GON4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054199: 93%, ENSRNOG00000020297: 93%
Entrez Gene ID: 54856
Uniprot ID: Q3T8J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GON4L
Alternative Gene Name: FLJ20203, GON-4, GON4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054199: 93%, ENSRNOG00000020297: 93%
Entrez Gene ID: 54856
Uniprot ID: Q3T8J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PVCMDSFQPMDDSLIAFQTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGLMNDDVGNEDE |
Documents & Links for Anti GON4L pAb (ATL-HPA074504) | |
Datasheet | Anti GON4L pAb (ATL-HPA074504) Datasheet (External Link) |
Vendor Page | Anti GON4L pAb (ATL-HPA074504) at Atlas |
Documents & Links for Anti GON4L pAb (ATL-HPA074504) | |
Datasheet | Anti GON4L pAb (ATL-HPA074504) Datasheet (External Link) |
Vendor Page | Anti GON4L pAb (ATL-HPA074504) |