Protein Description: golgi integral membrane protein 4
Gene Name: GOLIM4
Alternative Gene Name: GIMPC, GOLPH4, GPP130, P138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034109: 71%, ENSRNOG00000024213: 70%
Entrez Gene ID: 27333
Uniprot ID: O00461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GOLIM4
Alternative Gene Name: GIMPC, GOLPH4, GPP130, P138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034109: 71%, ENSRNOG00000024213: 70%
Entrez Gene ID: 27333
Uniprot ID: O00461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAED |
| Documents & Links for Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) | |
| Datasheet | Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) at Atlas |
| Documents & Links for Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) | |
| Datasheet | Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) |
| Citations for Anti GOLIM4 pAb (ATL-HPA001677 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |