Protein Description: golgin A5
Gene Name: GOLGA5
Alternative Gene Name: golgin-84, GOLIM5, ret-II, rfg5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021192: 92%, ENSRNOG00000007699: 92%
Entrez Gene ID: 9950
Uniprot ID: Q8TBA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GOLGA5
Alternative Gene Name: golgin-84, GOLIM5, ret-II, rfg5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021192: 92%, ENSRNOG00000007699: 92%
Entrez Gene ID: 9950
Uniprot ID: Q8TBA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS |
Documents & Links for Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) | |
Datasheet | Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) at Atlas |
Documents & Links for Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) | |
Datasheet | Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) |