Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation)

Catalog No:
ATL-HPA063876-25
$447.00

Description

Product Description

Protein Description: golgin A5
Gene Name: GOLGA5
Alternative Gene Name: golgin-84, GOLIM5, ret-II, rfg5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021192: 92%, ENSRNOG00000007699: 92%
Entrez Gene ID: 9950
Uniprot ID: Q8TBA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS
Gene Sequence QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS
Gene ID - Mouse ENSMUSG00000021192
Gene ID - Rat ENSRNOG00000007699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation)
Datasheet Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation)

Product Description

Protein Description: golgin A5
Gene Name: GOLGA5
Alternative Gene Name: golgin-84, GOLIM5, ret-II, rfg5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021192: 92%, ENSRNOG00000007699: 92%
Entrez Gene ID: 9950
Uniprot ID: Q8TBA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS
Gene Sequence QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS
Gene ID - Mouse ENSMUSG00000021192
Gene ID - Rat ENSRNOG00000007699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation)
Datasheet Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOLGA5 pAb (ATL-HPA063876 w/enhanced validation)