Anti GMPR2 pAb (ATL-HPA068782)

Atlas Antibodies

Catalog No: ATL-HPA068782-25

• 
• 

Product Description

Protein Description: guanosine monophosphate reductase 2
Gene Name: GMPR2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002326: 88%, ENSRNOG00000020216: 90%
Entrez Gene ID: 51292
Uniprot ID: Q9P2T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
• Gene Sequence: KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
• Gene ID - Mouse: ENSMUSG00000002326
• Gene ID - Rat: ENSRNOG00000020216
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.