Description
Product Description
Protein Description: guanosine monophosphate reductase 2
Gene Name: GMPR2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002326: 44%, ENSRNOG00000020216: 44%
Entrez Gene ID: 51292
Uniprot ID: Q9P2T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GMPR2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002326: 44%, ENSRNOG00000020216: 44%
Entrez Gene ID: 51292
Uniprot ID: Q9P2T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTSCLPALRFIATPRLSAMPHIDNDVKLDFKD |
Gene Sequence | MTSCLPALRFIATPRLSAMPHIDNDVKLDFKD |
Gene ID - Mouse | ENSMUSG00000002326 |
Gene ID - Rat | ENSRNOG00000020216 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GMPR2 pAb (ATL-HPA067884) | |
Datasheet | Anti GMPR2 pAb (ATL-HPA067884) Datasheet (External Link) |
Vendor Page | Anti GMPR2 pAb (ATL-HPA067884) at Atlas Antibodies |
Documents & Links for Anti GMPR2 pAb (ATL-HPA067884) | |
Datasheet | Anti GMPR2 pAb (ATL-HPA067884) Datasheet (External Link) |
Vendor Page | Anti GMPR2 pAb (ATL-HPA067884) |