Protein Description: glucocorticoid modulatory element binding protein 2
Gene Name: GMEB2
Alternative Gene Name: KIAA1269, P79PIF, PIF79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038705: 96%, ENSRNOG00000013339: 98%
Entrez Gene ID: 26205
Uniprot ID: Q9UKD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GMEB2
Alternative Gene Name: KIAA1269, P79PIF, PIF79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038705: 96%, ENSRNOG00000013339: 98%
Entrez Gene ID: 26205
Uniprot ID: Q9UKD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ |
Documents & Links for Anti GMEB2 pAb (ATL-HPA067455) | |
Datasheet | Anti GMEB2 pAb (ATL-HPA067455) Datasheet (External Link) |
Vendor Page | Anti GMEB2 pAb (ATL-HPA067455) at Atlas |
Documents & Links for Anti GMEB2 pAb (ATL-HPA067455) | |
Datasheet | Anti GMEB2 pAb (ATL-HPA067455) Datasheet (External Link) |
Vendor Page | Anti GMEB2 pAb (ATL-HPA067455) |