Anti GLRX2 pAb (ATL-HPA057224)

Atlas Antibodies

Catalog No: ATL-HPA057224-25

• 

Product Description

Protein Description: glutaredoxin 2
Gene Name: GLRX2
Alternative Gene Name: bA101E13.1, GRX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018196: 73%, ENSRNOG00000003385: 73%
Entrez Gene ID: 51022
Uniprot ID: Q9NS18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMA
• Gene Sequence: AAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMA
• Gene ID - Mouse: ENSMUSG00000018196
• Gene ID - Rat: ENSRNOG00000003385
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.