Anti GLO1 pAb (ATL-HPA059791)

Atlas Antibodies

Catalog No: ATL-HPA059791-100

• 
• 

Product Description

Protein Description: glyoxalase I
Gene Name: GLO1
Alternative Gene Name: GLOD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024026: 87%, ENSRNOG00000000541: 90%
Entrez Gene ID: 2739
Uniprot ID: Q04760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK
• Gene Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK
• Gene ID - Mouse: ENSMUSG00000024026
• Gene ID - Rat: ENSRNOG00000000541
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.