Anti GLMN pAb (ATL-HPA031448)

Atlas Antibodies

Catalog No: ATL-HPA031448-25

• 
• 

Product Description

Protein Description: glomulin, FKBP associated protein
Gene Name: GLMN
Alternative Gene Name: FAP48, FKBPAP, GLML, GVM, VMGLOM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029276: 81%, ENSRNOG00000002054: 77%
Entrez Gene ID: 11146
Uniprot ID: Q92990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV
• Gene Sequence: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV
• Gene ID - Mouse: ENSMUSG00000029276
• Gene ID - Rat: ENSRNOG00000002054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.