Protein Description: GLI family zinc finger 2
Gene Name: GLI2
Alternative Gene Name: HPE9, THP1, THP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048402: 90%, ENSRNOG00000007261: 95%
Entrez Gene ID: 2736
Uniprot ID: P10070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GLI2
Alternative Gene Name: HPE9, THP1, THP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048402: 90%, ENSRNOG00000007261: 95%
Entrez Gene ID: 2736
Uniprot ID: P10070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWA |
Documents & Links for Anti GLI2 pAb (ATL-HPA074275) | |
Datasheet | Anti GLI2 pAb (ATL-HPA074275) Datasheet (External Link) |
Vendor Page | Anti GLI2 pAb (ATL-HPA074275) at Atlas |
Documents & Links for Anti GLI2 pAb (ATL-HPA074275) | |
Datasheet | Anti GLI2 pAb (ATL-HPA074275) Datasheet (External Link) |
Vendor Page | Anti GLI2 pAb (ATL-HPA074275) |
Citations for Anti GLI2 pAb (ATL-HPA074275) – 2 Found |
Belgacemi, Randa; Luczka, Emilie; Ancel, Julien; Diabasana, Zania; Perotin, Jeanne-Marie; Germain, Adeline; Lalun, Nathalie; Birembaut, Philippe; Dubernard, Xavier; Mérol, Jean-Claude; Delepine, Gonzague; Polette, Myriam; Deslée, Gaëtan; Dormoy, Valérian. Airway epithelial cell differentiation relies on deficient Hedgehog signalling in COPD. Ebiomedicine. 2020;51( 31877414):102572. PubMed |
Ancel, Julien; Belgacemi, Randa; Perotin, Jeanne-Marie; Diabasana, Zania; Dury, Sandra; Dewolf, Maxime; Bonnomet, Arnaud; Lalun, Nathalie; Birembaut, Philippe; Polette, Myriam; Deslée, Gaëtan; Dormoy, Valérian. Sonic hedgehog signalling as a potential endobronchial biomarker in COPD. Respiratory Research. 2020;21(1):207. PubMed |