Anti GLE1 pAb (ATL-HPA061560)

Atlas Antibodies

Catalog No: ATL-HPA061560-25

• 

Product Description

Protein Description: GLE1 RNA export mediator
Gene Name: GLE1
Alternative Gene Name: GLE1L, hGLE1, LCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019715: 92%, ENSRNOG00000015237: 89%
Entrez Gene ID: 2733
Uniprot ID: Q53GS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ
• Gene Sequence: NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ
• Gene ID - Mouse: ENSMUSG00000019715
• Gene ID - Rat: ENSRNOG00000015237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.