Description
Product Description
Protein Description: GLE1 RNA export mediator
Gene Name: GLE1
Alternative Gene Name: GLE1L, hGLE1, LCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019715: 92%, ENSRNOG00000015237: 89%
Entrez Gene ID: 2733
Uniprot ID: Q53GS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GLE1
Alternative Gene Name: GLE1L, hGLE1, LCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019715: 92%, ENSRNOG00000015237: 89%
Entrez Gene ID: 2733
Uniprot ID: Q53GS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ |
Gene Sequence | NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ |
Gene ID - Mouse | ENSMUSG00000019715 |
Gene ID - Rat | ENSRNOG00000015237 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti GLE1 pAb (ATL-HPA061560) | |
Datasheet | Anti GLE1 pAb (ATL-HPA061560) Datasheet (External Link) |
Vendor Page | Anti GLE1 pAb (ATL-HPA061560) at Atlas Antibodies |
Documents & Links for Anti GLE1 pAb (ATL-HPA061560) | |
Datasheet | Anti GLE1 pAb (ATL-HPA061560) Datasheet (External Link) |
Vendor Page | Anti GLE1 pAb (ATL-HPA061560) |