Protein Description: galactosidase, beta 1
Gene Name: GLB1
Alternative Gene Name: EBP, ELNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045594: 47%, ENSRNOG00000010196: 46%
Entrez Gene ID: 2720
Uniprot ID: P16278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GLB1
Alternative Gene Name: EBP, ELNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045594: 47%, ENSRNOG00000010196: 46%
Entrez Gene ID: 2720
Uniprot ID: P16278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV |
Documents & Links for Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation) | |
Datasheet | Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation) at Atlas |
Documents & Links for Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation) | |
Datasheet | Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation) |