Anti GKN2 pAb (ATL-HPA057765 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA057765-25

• 

Product Description

Protein Description: gastrokine 2
Gene Name: GKN2
Alternative Gene Name: blottin, BRICD1B, GDDR, PRO813, TFIZ1, VLTI465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030049: 59%, ENSRNOG00000009256: 65%
Entrez Gene ID: 200504
Uniprot ID: Q86XP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
• Gene Sequence: PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
• Gene ID - Mouse: ENSMUSG00000030049
• Gene ID - Rat: ENSRNOG00000009256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.